DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and tll2l

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001016661.1 Gene:tll2l / 549415 XenbaseID:XB-GENE-478930 Length:500 Species:Xenopus tropicalis


Alignment Length:100 Identity:27/100 - (27%)
Similarity:40/100 - (40%) Gaps:27/100 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 MPTP---SENYA-GQTAVVTGWGALSEGGPISDTLQEVE-VPILSQEECRNSNYGESKITDNMIC 251
            :|.|   |..|. .|.|::|  .|:.|    .:||..|: ||..:::...|.|.|..       |
 Frog    89 VPVPFTVSPGYTKSQLALIT--AAMQE----FETLTCVDFVPKTNEKNVININNGNG-------C 140

  Fly   252 AGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIV 286
            ..|:         |.|||...|..|..:..:.||:
 Frog   141 WSYI---------GRSGGVQQVSLSKQSCMVKGII 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 27/99 (27%)
Tryp_SPc 83..314 CDD:238113 27/99 (27%)
tll2lNP_001016661.1 ZnMc_hatching_enzyme 86..268 CDD:239810 27/99 (27%)
CUB 272..382 CDD:238001
CUB 385..495 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.