DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and f10

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001015728.1 Gene:f10 / 548445 XenbaseID:XB-GENE-971433 Length:464 Species:Xenopus tropicalis


Alignment Length:241 Identity:86/241 - (35%)
Similarity:137/241 - (56%) Gaps:23/241 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMW-FGNFYCGASLVNDQYALTAAHCVNGF-YHRLITVRL---LEHN 141
            |||||:|....|.||..:|:. ....:||.::::.::.||||||:|.. |.:::...|   :...
 Frog   227 RIVGGRECSQGECPWQALLVSDEDEGFCGGTILSREFILTAAHCMNQTKYFKVVVGELNTKISEG 291

  Fly   142 RQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQT--- 203
            .:..|      :|.::::||::....:|.|||:|:..|.:....::.|.|:|.|  .:|.|.   
 Frog   292 TESIH------KVEKIIMHPRFVKSTYDYDIAVIKLKEAINFTENIIPACIPDP--EFADQVLMN 348

  Fly   204 ---AVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQG 265
               |:|:|:|.:.|.|..:.|||.::||.:.:..|:.|:  ...||:||.|||: :...||:|||
 Frog   349 EPDAMVSGFGRIHERGRQASTLQMLQVPYIKRHSCKESS--TFAITENMFCAGF-DTEVKDACQG 410

  Fly   266 DSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311
            ||||| ||......|.:.||||||||||:....||||:|...:.|:
 Frog   411 DSGGP-HVTPFKGTYFVTGIVSWGEGCARKGKFGVYTKVSKLHRWL 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 85/239 (36%)
Tryp_SPc 83..314 CDD:238113 85/240 (35%)
f10NP_001015728.1 GLA 22..84 CDD:214503
EGF_CA 85..121 CDD:238011
FXa_inhibition 128..163 CDD:373209
Tryp_SPc 228..456 CDD:238113 85/240 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.