DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Tpsab1

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_062195.2 Gene:Tpsab1 / 54271 RGDID:3066 Length:310 Species:Rattus norvegicus


Alignment Length:265 Identity:97/265 - (36%)
Similarity:137/265 - (51%) Gaps:58/265 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 RHRIVGGQETEVHEYPWMIML-----MWFGNFYCGASLVNDQYALTAAHCVNG------------ 127
            |..||||||...:::||.:.|     .|.  .:||.||::.|:.|||||||..            
  Rat    63 REGIVGGQEASGNKWPWQVSLRVNDTYWM--HFCGGSLIHPQWVLTAAHCVGPNKADPNKLRVQL 125

  Fly   128 -----FYH-RLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGID 186
                 :|| .|:|                   ||:::.||.:......:||||::...||.:..:
  Rat   126 RKQYLYYHDHLLT-------------------VSQIISHPDFYIAQDGADIALLKLTNPVNITSN 171

  Fly   187 MHPVCMPTPSENY-AGQTAVVTGWGALSE--GGPISDTLQEVEVPILSQEEC-----RNSNYGES 243
            :|.|.:|..||.: :|....|||||.::.  ..|....|:||:|||:....|     :..|.|::
  Rat   172 VHTVSLPPASETFPSGTLCWVTGWGNINNDVSLPPPFPLEEVQVPIVENRLCDLKYHKGLNTGDN 236

  Fly   244 K--ITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGS 306
            .  :.|:|:|||   ..|.||||||||||: |....|.:..||:||||||||:||.||:||||..
  Rat   237 VHIVRDDMLCAG---NEGHDSCQGDSGGPL-VCKVEDTWLQAGVVSWGEGCAQPNRPGIYTRVTY 297

  Fly   307 FNDWI 311
            :.|||
  Rat   298 YLDWI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 94/261 (36%)
Tryp_SPc 83..314 CDD:238113 96/262 (37%)
Tpsab1NP_062195.2 Tryp_SPc 66..302 CDD:214473 94/260 (36%)
Tryp_SPc 66..302 CDD:238113 94/260 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346470
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.