DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and prss60.2

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001099071.1 Gene:prss60.2 / 541408 ZFINID:ZDB-GENE-050320-109 Length:328 Species:Danio rerio


Alignment Length:289 Identity:100/289 - (34%)
Similarity:146/289 - (50%) Gaps:44/289 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 CGNINTRHRIVGGQETEVHEYPWMIMLM--WFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVR 136
            ||......|||||.......:||.:.|.  .:|..:||.||::.::.||||||:.|.....:.|.
Zfish    25 CGQAPLNSRIVGGVNAPEGSWPWQVSLQSPRYGGHFCGGSLISSEWVLTAAHCLPGVSESSLVVY 89

  Fly   137 LLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENY-A 200
            |....:|..:.....|.|:::::|..|::...|:||||:|.:..|.....:.|||:...:..| |
Zfish    90 LGRRTQQGVNTHETSRNVAKIIVHSSYNSNTNDNDIALLRLSSAVTFNDYIRPVCLAAQNSVYSA 154

  Fly   201 GQTAVVTGWGALSEGG--PISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSC 263
            |.::.:||||.:..|.  |....|||..:|:::.:.| |:..|...:|:|||||| :.:||||:|
Zfish   155 GTSSWITGWGDVQAGVNLPAPGILQETMIPVVANDRC-NAQLGSGTVTNNMICAG-LAKGGKDTC 217

  Fly   264 QGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAE--------------- 313
            |||||||| |......:..|||.|||.|||.||:|||||||..:..||:.               
Zfish   218 QGDSGGPM-VTRLCTVWIQAGITSWGYGCADPNSPGVYTRVSQYQSWISSKISQNQPGFILFTPP 281

  Fly   314 ---------------------NTRDACSC 321
                                 ||.:.|:|
Zfish   282 SSCTSSSLTSSSCSGRCNEVYNTLNRCNC 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 92/233 (39%)
Tryp_SPc 83..314 CDD:238113 93/271 (34%)
prss60.2NP_001099071.1 Tryp_SPc 33..264 CDD:214473 92/233 (39%)
Tryp_SPc 34..267 CDD:238113 93/235 (40%)
Somatomedin_B 296..326 CDD:295334 4/15 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587885
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3731
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.