DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and C1RL

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_057630.2 Gene:C1RL / 51279 HGNCID:21265 Length:487 Species:Homo sapiens


Alignment Length:323 Identity:90/323 - (27%)
Similarity:139/323 - (43%) Gaps:67/323 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ATALGDLACATP-SLRSASDPEKILNNLAQLRQSSFLDWIQSILGPEVPAEWSSPAKRECAECSC 74
            |.|.|.|.|||| :.:...|.|::|                                 :|... |
Human   202 AAAAGALTCATPGTWKDRQDGEEVL---------------------------------QCMPV-C 232

  Fly    75 GN----INTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITV 135
            |.    |......:|....::..:||.......|.  .|.:|:.|::.|||||.:  :....:::
Human   233 GRPVTPIAQNQTTLGSSRAKLGNFPWQAFTSIHGR--GGGALLGDRWILTAAHTI--YPKDSVSL 293

  Fly   136 R-------LLEHNRQDSHVKIVDRRVSRVLIHPKY---STRNFDSDIALIRFNEPVRLGIDMHPV 190
            |       .|.|...|..:|:.:..|.||::||.|   .:.||..||||:.....:.||.::.||
Human   294 RKNQSVNVFLGHTAIDEMLKLGNHPVHRVVVHPDYRQNESHNFSGDIALLELQHSIPLGPNVLPV 358

  Fly   191 CMPTPSENY-AGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECR---NSNYGESKITDNMIC 251
            |:|.....| :|....|:|:|  .|.|.::..|:...:|:..:|.|.   .........:|||.|
Human   359 CLPDNETLYRSGLLGYVSGFG--MEMGWLTTELKYSRLPVAPREACNAWLQKRQRPEVFSDNMFC 421

  Fly   252 AGYVEQGGKDS-CQGDSGGPMHVLGSGDAYQ--LAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311
            .|  ::..:.| ||||||. ::|:....|:.  ..||||||.||.:  ....||:|.|:.|||
Human   422 VG--DETQRHSVCQGDSGS-VYVVWDNHAHHWVATGIVSWGIGCGE--GYDFYTKVLSYVDWI 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 73/245 (30%)
Tryp_SPc 83..314 CDD:238113 75/246 (30%)
C1RLNP_057630.2 CUB 40..162 CDD:238001
Tryp_SPc 247..480 CDD:238113 75/244 (31%)
Tryp_SPc 247..479 CDD:214473 73/242 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.