DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Prss53

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:366 Identity:83/366 - (22%)
Similarity:140/366 - (38%) Gaps:84/366 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LRQSSFLDWIQSIL--GPEVPAEWSSPAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMW 102
            :|||    |...:|  |..:..|....|:|.|.:...|....:.     ..|...|:||...:..
  Rat     1 MRQS----WGPELLIVGAVIVIEGLQAAQRACGQRGPGPPEPQE-----GNTLPGEWPWQASVRR 56

  Fly   103 FGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRL------LEHNRQDSHVKIVDRRVSRVLIHP 161
            .|...|..|||.|.:.||||||    :.::.|..|      |...:|:......:......|..|
  Rat    57 QGVHICSGSLVADTWVLTAAHC----FEKMATAELSSWSVVLGSLKQEGLSPGAEEVGVAALQLP 117

  Fly   162 K-YSTRNFDSDIALIRFNEPVRLGIDMH-PVCMPTPSENYA-GQTAVVTGWGALSEGG------- 216
            | |:..:..||:||::...|:     :| .:|:|.|:.::. |.:...|||...:..|       
  Rat   118 KAYNHYSQGSDLALLQLTHPI-----VHTTLCLPQPTHHFPFGASCWATGWDQNTSDGKYCPRHK 177

  Fly   217 ------------------------------PISDTLQEVEVPILSQEECRNSNYGE-------SK 244
                                          |:|.||:.:.:.::|:..| |..|..       :.
  Rat   178 SRESQTGSVLTVLALCSHCVSELDSTLSPLPVSRTLRNLRLRLISRPTC-NCLYNRLHQRLLANP 241

  Fly   245 ITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFND 309
            ....|:|.| .:.|.:..||||||||:........:...||:|:...||:.:.|.:.|.:.:.:.
  Rat   242 ARSGMLCGG-AQPGVQGPCQGDSGGPVMCREPDGHWVQVGIISFTSNCAQEDTPVLLTDMAAHSS 305

  Fly   310 WIAENTRDACSCAQPEAAGEPASPMETTEQGDQENTTANGA 350
            |:..:...|....|     :|.    ..:..|:.:..|.|:
  Rat   306 WLQAHVDRAAFLVQ-----DPG----VVKMSDENSCVACGS 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 65/281 (23%)
Tryp_SPc 83..314 CDD:238113 66/283 (23%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113 65/275 (24%)
Tryp_SPc 341..561 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.