DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Tmprss11f

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_038948844.1 Gene:Tmprss11f / 498345 RGDID:1560675 Length:459 Species:Rattus norvegicus


Alignment Length:296 Identity:101/296 - (34%)
Similarity:148/296 - (50%) Gaps:53/296 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ILNNLAQLRQSSFLDWIQSILGPEVPAEWSSPAKRECAECSCGNINTRHRIVGGQETEVH-EYPW 96
            :||:...:|.||          ..:|...||               |..|||.|:||.:. |:||
  Rat   202 LLNSRCGIRMSS----------SNIPLPASS---------------TTERIVQGRETAMEGEWPW 241

  Fly    97 MIMLMWFG-NFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSH----------VKIV 150
            ...|...| ...|||:|:::.:.||||||   |:          .||..|.          ..:|
  Rat   242 QASLQLIGAGHQCGATLISNTWLLTAAHC---FW----------KNRDPSKWIATFGTTITPPLV 293

  Fly   151 DRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQTAV-VTGWGALSE 214
            .|.|.|::||.:|...:.::||||.:....|.....:..||:|..|.....:|:| |||:|::.:
  Rat   294 KRSVGRIIIHEEYHRDSNENDIALAQLTSRVEFSNVVQRVCLPDSSMKLPPKTSVFVTGFGSIVD 358

  Fly   215 GGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDA 279
            .||..:.|::..|..:..:.|...:..:..||..|:|||::| |..|:|:||||||: |..:.|.
  Rat   359 DGPTQNKLRQARVETIGSDVCNQKDVYDGLITPGMLCAGFME-GKVDACKGDSGGPL-VYDNRDI 421

  Fly   280 YQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENT 315
            :.:.||||||:.||.||.|||||||..:.||||..|
  Rat   422 WYIVGIVSWGQSCALPNKPGVYTRVSKYRDWIASKT 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 88/241 (37%)
Tryp_SPc 83..314 CDD:238113 90/243 (37%)
Tmprss11fXP_038948844.1 SEA 80..185 CDD:396113
Tryp_SPc 227..456 CDD:238113 90/243 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.