DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Prss33

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001102497.1 Gene:Prss33 / 497873 RGDID:1583742 Length:277 Species:Rattus norvegicus


Alignment Length:261 Identity:104/261 - (39%)
Similarity:139/261 - (53%) Gaps:25/261 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 RECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHR 131
            :|||  :||......|||||::.:..|:||...:...|...||.||:..|:.|||.||   |..|
  Rat    20 QECA--ACGQPRMSSRIVGGRDAQDGEWPWQTSIQHRGAHVCGGSLIAPQWVLTAGHC---FSRR 79

  Fly   132 L------ITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPV 190
            :      :.:..|..:...||..:|.  |.|||:.|.||......|:||::.:.||.|...:.||
  Rat    80 VLPSEYSVLLGALSLDVTSSHELLVP--VLRVLLPPDYSEDEARGDLALLQLSHPVSLSARIQPV 142

  Fly   191 CMPTP-SENYAGQTAVVTGWGALSEGGPI--SDTLQEVEVPILSQEEC-------RNSNYGESKI 245
            |:|.| |....|....|||||:||.|.|:  ...||.|.||:|....|       .|....|..:
  Rat   143 CLPAPGSHPPPGSPCWVTGWGSLSPGVPLPKGRPLQGVRVPLLDSRACDRLYHMGANVPKSERIV 207

  Fly   246 TDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDW 310
            ....:|||| .:|.||:||||||||:..:.|| .:.|.|:||||:|||.||.|||||.|..::.|
  Rat   208 LPGNLCAGY-RRGHKDACQGDSGGPLTCMESG-RWVLVGVVSWGKGCALPNRPGVYTNVAKYSPW 270

  Fly   311 I 311
            |
  Rat   271 I 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 97/244 (40%)
Tryp_SPc 83..314 CDD:238113 98/245 (40%)
Prss33NP_001102497.1 Tryp_SPc 33..271 CDD:214473 97/244 (40%)
Tryp_SPc 34..272 CDD:238113 98/245 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.