DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and cela1.2

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001011493.1 Gene:cela1.2 / 496993 XenbaseID:XB-GENE-5739190 Length:265 Species:Xenopus tropicalis


Alignment Length:266 Identity:83/266 - (31%)
Similarity:137/266 - (51%) Gaps:34/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 CAECSCGN----INTRHRIVGGQETEVHEYPWMIMLMWF--GNFY--CGASLVNDQYALTAAHCV 125
            |.:||  |    |....|::||.|.:.:.:||.:.|.:.  |::|  ||.||:.....|||||||
 Frog    13 CGQCS--NDIRLIEDHERVIGGTEVQRNSWPWQVSLQYLSGGSWYHTCGGSLIRANRVLTAAHCV 75

  Fly   126 NGFYHRLITVRLL--EHN--RQDSHVKIVDRRVSRVLIHPKYSTRNFDS--DIALIRFNEPVRLG 184
            :    |.::.|::  :||  :.|...:.:.  |||::.|..::..|..:  ||:::..:....|.
 Frog    76 D----RAVSYRVVVGDHNIYQNDGTEQYIS--VSRIVKHANWNPNNIAAGYDISILHLSSSATLN 134

  Fly   185 IDMHPVCMPTP----SENYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKI 245
            ..:....:|..    :.||   ..||||||..|..|.::..||:..:|:::...|.:.:|..|.:
 Frog   135 SYVKLAQLPADNVVLAHNY---NCVVTGWGKTSNNGNLASVLQQAPLPVIAHSTCSSGSYWGSTV 196

  Fly   246 TDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSW--GEGCAKPNAPGVYTRVGSFN 308
            ...|:|||  ..|.:..||||||||::...:| .||:.|:.|:  ..||:....|.|:|||.::.
 Frog   197 KSTMVCAG--GDGVRSGCQGDSGGPLNCPVNG-VYQVHGVTSFVSSSGCSTYLKPTVFTRVSAYI 258

  Fly   309 DWIAEN 314
            .||..|
 Frog   259 GWINNN 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 75/244 (31%)
Tryp_SPc 83..314 CDD:238113 76/246 (31%)
cela1.2NP_001011493.1 Tryp_SPc 29..264 CDD:238113 76/246 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.