DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and ctrc

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001008077.1 Gene:ctrc / 493439 XenbaseID:XB-GENE-5790348 Length:268 Species:Xenopus tropicalis


Alignment Length:240 Identity:85/240 - (35%)
Similarity:136/240 - (56%) Gaps:12/240 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMWFG-----NFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHN 141
            |:|||::...|.:||.|.|.:.|     ...||.:|:::|:.||||||::.  .|:..|.|.:|:
 Frog    28 RVVGGEDVVPHSWPWQISLQYQGTSGAWGHTCGGTLISEQWVLTAAHCISS--GRVYRVFLGKHS 90

  Fly   142 RQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQ-TAV 205
            .|....:.|.....::::|.|:::....:|||||:.::|..|...:.|.|:|:.....|.. ...
 Frog    91 LQQDEAEAVAITPEKIIVHEKWNSLFIINDIALIKLSQPAPLSEAIQPACIPSSGAILANDFPCF 155

  Fly   206 VTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGP 270
            |||||.|...|||:|.||:..:|::....|...::..|::...|:|||  ..|....|.||||||
 Frog   156 VTGWGRLYTNGPIADNLQQALLPVVDHATCTLRDWWGSQVQTTMVCAG--GDGIVSGCNGDSGGP 218

  Fly   271 MHVLGSGDAYQLAGIVSWGEG--CAKPNAPGVYTRVGSFNDWIAE 313
            ::...:|.|:::.||||:|.|  |.....|.|:|||.::||||:|
 Frog   219 LNCQAAGGAWEVHGIVSFGSGISCNYAKKPTVFTRVSAYNDWISE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 82/236 (35%)
Tryp_SPc 83..314 CDD:238113 84/239 (35%)
ctrcNP_001008077.1 Tryp_SPc 29..264 CDD:238113 84/239 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.