DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and tll1

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001008039.1 Gene:tll1 / 493401 XenbaseID:XB-GENE-479941 Length:495 Species:Xenopus tropicalis


Alignment Length:273 Identity:61/273 - (22%)
Similarity:89/273 - (32%) Gaps:113/273 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 HLLLI-----LATAL---GDLACATPSLRSASDPEKILNNLAQLRQSSFLDWIQSILGPEVPAEW 61
            ||:|:     |:..|   |.|  .||..:...||..  |||       :.|.::        |..
 Frog     6 HLILLFCLMGLSLTLPLSGTL--PTPKSQDGKDPAD--NNL-------YTDIMK--------ANQ 51

  Fly    62 SSPAKR--------------ECAEC-----SCGNINTRHRI--------VGGQETEVHEYPWMIM 99
            .|...|              .|.||     |.|.:...:.:        |....|.:.||..:..
 Frog    52 KSKKLRIHGDIALKTDRNAINCTECLWPKSSDGFVYVPYTVSSDYSQDEVNAITTAMKEYEGLTC 116

  Fly   100 LM---WFG-----------------NFYCGASLVN-----DQYALTAAHCVN---GFYHRLITVR 136
            :.   |.|                 .:|.|:..|:     ..|.....|.:|   ||||      
 Frog   117 VQFTPWTGEDDYLAIQSLDGCWSYIGYYGGSQAVSLLKGFCAYNGGVQHELNHALGFYH------ 175

  Fly   137 LLEHNR--QDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGID------MHPVCMP 193
              ||||  :|.:|.|:.:.:|     |: :..|||.    |..|   .||:|      :|  ...
 Frog   176 --EHNRSDRDDYVTIMYQYIS-----PE-NIGNFDK----ISTN---NLGVDYDYSSILH--YAG 223

  Fly   194 TPSENYAGQTAVV 206
            ....|.:||..:|
 Frog   224 NAFSNTSGQNTIV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 38/169 (22%)
Tryp_SPc 83..314 CDD:238113 38/168 (23%)
tll1NP_001008039.1 ZnMc_hatching_enzyme 83..265 CDD:239810 39/177 (22%)
CUB 269..379 CDD:238001
CUB 382..494 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.