DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and epsilonTry

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster


Alignment Length:241 Identity:91/241 - (37%)
Similarity:126/241 - (52%) Gaps:21/241 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRL-LEHNRQDS 145
            |||||.||.:..:|:.:.|..:|:.:||.|:.:....:|||||:.....:.:.:|: ..:.|...
  Fly    30 RIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVITAAHCLQSIEAKDLKIRVGSTYWRSGG 94

  Fly   146 HVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPV--RLGIDMHPVCMPTPSENYAGQTAVVTG 208
            .|    ..|.....|..|::|...:|||:||....:  |..|....:....|.|   |.||||:|
  Fly    95 SV----HSVRSFRNHEGYNSRTMVNDIAIIRIESDLSFRSSIREIRIADSNPRE---GATAVVSG 152

  Fly   209 WGALSEGG-PISDTLQEVEVPILSQEECRNSNYG-ESKITDNMICAGYVEQGGKDSCQGDSGGPM 271
            ||....|| .|.|.|..|::.|:....||:..:| ..||.|.|:|| |...  ||:|||||||| 
  Fly   153 WGTTESGGSTIPDHLLAVDLEIIDVSRCRSDEFGYGKKIKDTMLCA-YAPH--KDACQGDSGGP- 213

  Fly   272 HVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTRD 317
              |.|||  :|.|:||||.||.....||||..|..|::|| |.|.:
  Fly   214 --LVSGD--RLVGVVSWGYGCGDVRYPGVYADVAHFHEWI-ERTAE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 87/233 (37%)
Tryp_SPc 83..314 CDD:238113 88/235 (37%)
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 87/233 (37%)
Tryp_SPc 31..252 CDD:238113 89/236 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.