DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and zgc:92590

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001007055.1 Gene:zgc:92590 / 474322 ZFINID:ZDB-GENE-041024-15 Length:247 Species:Danio rerio


Alignment Length:246 Identity:100/246 - (40%)
Similarity:145/246 - (58%) Gaps:24/246 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 CSCGNINTRHRIVGGQETEVHEYPWMIMLMW-FGNFYCGASLVNDQYALTAAHCVNGFYHRLITV 135
            ||..:     :|:||.|...:..||.|.|.: .|..:|||||:||::|::||||.  .....:||
Zfish    15 CSADD-----KIIGGYECSPNSQPWQIYLTYDNGQRWCGASLINDRWAVSAAHCY--LVANRLTV 72

  Fly   136 RLLEHN---RQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSE 197
            .|.|||   .:.:..:|   :..:|:.||||:....|:|..||:..||......:.||.: |.|.
Zfish    73 HLGEHNVAVEEGTEQRI---KAEKVIPHPKYNDYTLDNDFMLIKLKEPAVFNQYVQPVPL-TTSC 133

  Fly   198 NYAGQTAVVTGWGALSEGGPI-SDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKD 261
            :..|:..:|:|||.|...|.: .|.||.:.:|:|::.:|..: || .:||.||.|||::| ||||
Zfish   134 SSEGEQCLVSGWGNLINTGVVYPDVLQCLNLPVLTRAQCEGA-YG-WQITKNMFCAGFME-GGKD 195

  Fly   262 SCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIA 312
            :||||||||  |:.:|   :|.|:||||.|||....|||||.|..:.||:|
Zfish   196 ACQGDSGGP--VICNG---ELRGVVSWGYGCADSGYPGVYTEVCRYTDWVA 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 96/233 (41%)
Tryp_SPc 83..314 CDD:238113 98/235 (42%)
zgc:92590NP_001007055.1 Tryp_SPc 20..240 CDD:214473 96/233 (41%)
Tryp_SPc 21..243 CDD:238113 98/235 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.