DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CLIPB18

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_001238237.1 Gene:CLIPB18 / 4578288 VectorBaseID:AGAP009215 Length:359 Species:Anopheles gambiae


Alignment Length:321 Identity:104/321 - (32%)
Similarity:151/321 - (47%) Gaps:64/321 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 GPEV--PAEW---------SSPAKRE-----------CAECSCGNINTRH--------------- 81
            ||..  ||:|         |...|||           |...:.||.|.|.               
Mosquito    46 GPHYHEPAKWTEELLNEFRSKVCKREQSNGRNLYKVCCKRAATGNKNNRERGLATLDLEECGAYS 110

  Fly    82 --RIVGGQETEVHEYPWMIMLMWFG-NFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHN-- 141
              |:..|||..:.::|||.:||... .|.||.:|:|.:|.||||||:..  .::.||||.|.:  
Mosquito   111 ADRMAYGQEARLFQFPWMALLMLNSVKFVCGGTLINRRYVLTAAHCLKN--TQVTTVRLGEFDIS 173

  Fly   142 -------RQDSHV-KIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMP-TPSE 197
                   |.|.|. ...|..:.:.::|..||||...:||.|||..|......::.|:|:| :|:.
Mosquito   174 TPIDYDKRGDQHAPPPQDIAIEQTIVHEAYSTRLKVNDIGLIRMAEEAAYNDNVSPICLPVSPAM 238

  Fly   198 NYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEEC-----RNSNYGESKITDNMICAGYVEQ 257
            .....|..|.|||| :|....|:.|...:|.:|:.::|     |..:|  :||.::.:||  :..
Mosquito   239 RTTQTTYFVAGWGA-TESAFYSNRLLFGKVALLTNDQCAQHLLRVDSY--TKINNDQMCA--IGA 298

  Fly   258 GGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWG-EGCAKPNAPGVYTRVGSFNDWIAENTRD 317
            ...|:|.||||||:..:.....|...|:||.| ..|.|.:||||||||.::.|||.|:..:
Mosquito   299 NLTDNCTGDSGGPLKTISINARYVQYGVVSLGLRTCGKQSAPGVYTRVENYADWILEHLEE 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 87/246 (35%)
Tryp_SPc 83..314 CDD:238113 88/248 (35%)
CLIPB18XP_001238237.1 Tryp_SPc 117..356 CDD:238113 88/245 (36%)
Tryp_SPc 117..353 CDD:214473 86/242 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.