DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP010015

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_001238092.2 Gene:AgaP_AGAP010015 / 4577984 VectorBaseID:AGAP010015 Length:239 Species:Anopheles gambiae


Alignment Length:258 Identity:72/258 - (27%)
Similarity:114/258 - (44%) Gaps:53/258 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRL-------------I 133
            ||:.|.:.....||:::.:.:...|.|..:::...:.|:..:|...|..::             |
Mosquito     9 RILNGLKVNPERYPFIVNIYFEDQFLCSGNIITPSHVLSLEYCFEIFVFQMSIYGGGTSPLSGGI 73

  Fly   134 TVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTR--NFDSDIALIRFNEPVRL--GI-DMHPVCMP 193
            ::                 .|:::.|||.:..|  ..|.|:|:|  :.|:..  |: :|..:.:.
Mosquito    74 SI-----------------PVNKITIHPNFEYRYGRSDFDVAVI--SVPINTFQGMANMASIALQ 119

  Fly   194 TPSENYAGQTAVVTGWGALSEGGPIS-DTLQEVEVPILSQEECRNS--NYGESKITDNMICAGYV 255
            | ||...|....|.|||.....|||. :.|....:.|:||..|..|  :..|: :|.|||||.|.
Mosquito   120 T-SEVLPGSRCYVIGWGVSKIFGPIDLNGLHYGTMNIVSQSACSRSWASVNEN-VTSNMICAKYC 182

  Fly   256 EQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGE-GCAKPNAPGVYTRV--GSFNDWIAENT 315
              .|.|.|.||.|||:...|     :|.||:.:.| ||.| |.|.|:||:  .|...:|...|
Mosquito   183 --FGVDICYGDLGGPLVCDG-----KLTGIIGYTEYGCTK-NNPAVFTRIMAPSIRSFIRNET 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 70/252 (28%)
Tryp_SPc 83..314 CDD:238113 70/254 (28%)
AgaP_AGAP010015XP_001238092.2 Tryp_SPc 9..224 CDD:214473 68/243 (28%)
Tryp_SPc 10..235 CDD:238113 70/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.