DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP012269

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_001238284.2 Gene:AgaP_AGAP012269 / 4577485 VectorBaseID:AGAP012269 Length:649 Species:Anopheles gambiae


Alignment Length:263 Identity:69/263 - (26%)
Similarity:123/263 - (46%) Gaps:32/263 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SCG--NINTRHRIVGGQETEVHEYPWMIMLMWFG----NFYCGASLVNDQYALTAAHC---VNGF 128
            :||  .:.|.|.:..|.:.:...:||...:....    ::.||.|::::...||||||   ||| 
Mosquito    29 TCGKRRVKTIHLVHNGIDAKPGHWPWHAAIFHRKGDQMDYACGGSIIDENTILTAAHCVFLVNG- 92

  Fly   129 YHRLITVRLLEHNRQDSHVK-----IVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMH 188
               |:.|..:..:....|:|     :.:..|..:::||.|::..|.:|||||:....:.:...:.
Mosquito    93 ---LLPVSRISVHLGRVHLKEVSEFVQEHTVQELIVHPGYNSSRFVNDIALIKLTGSITMSEFVQ 154

  Fly   189 PVCMPTPSEN---YAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSN--YGESKITDN 248
            |||:.|..:|   ..|:|..:.|:| |:|...:|:.|::..:.::....|..|:  ...:::|..
Mosquito   155 PVCLWTMDKNQELIVGKTGTLVGFG-LNEQDVVSEQLKQASIGVVDALTCIKSDRLSFANQLTAE 218

  Fly   249 MICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSW-----GEGCAKPNAPGVYTRVGSFN 308
            |.|.|  .|....:|.|||||.:.....|..: :.|:||:     ..|...|:....|..|..:.
Mosquito   219 MFCGG--GQSNVSACNGDSGGGLFFNVEGKWF-VRGVVSFIPVRQRTGLCDPSKYTAYADVAKYL 280

  Fly   309 DWI 311
            .||
Mosquito   281 GWI 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 63/250 (25%)
Tryp_SPc 83..314 CDD:238113 65/251 (26%)
AgaP_AGAP012269XP_001238284.2 Tryp_SPc 41..285 CDD:238113 65/251 (26%)
Tryp_SPc 43..283 CDD:214473 63/247 (26%)
Tryp_SPc 418..636 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.