DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP004569

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_001237553.3 Gene:AgaP_AGAP004569 / 4577070 VectorBaseID:AGAP004569 Length:296 Species:Anopheles gambiae


Alignment Length:283 Identity:119/283 - (42%)
Similarity:168/283 - (59%) Gaps:7/283 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 WIQSILGPEVPAEWSSPA--KRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGA 110
            |:..:....||. .::|.  ..|..:|.||.....:|||||.|...|::||:..|...|..||||
Mosquito    15 WVLMLTTLAVPL-LAAPVYNSSESCDCVCGVGGRTNRIVGGSEAAAHQFPWLAGLFRQGKLYCGA 78

  Fly   111 SLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALI 175
            |:|:..:.:|||||||.|....|.|.|..||....:.::  |||.|::.|..:....|::||||:
Mosquito    79 SVVSRNFLVTAAHCVNSFEASEIRVYLGGHNIAKDYTEL--RRVKRIIDHEDFDIFTFNNDIALL 141

  Fly   176 RFNEPVRLGIDMHPVCMPTPS-ENYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSN 239
            ..::|:|.|..:.|.|:|..| .::.|...||.|||.:.|....|.||:.|||||.|||:|.::.
Mosquito   142 ELDKPLRYGPTIQPACLPDGSVMDFTGTIGVVAGWGRVEEKRAPSKTLRSVEVPIWSQEQCLDAG 206

  Fly   240 YGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRV 304
            ||..||:.||:|||| ..|.||:||||||||||.:|...:.::.|:||||.|||:||.||:|||:
Mosquito   207 YGSKKISANMMCAGY-HDGQKDACQGDSGGPMHKMGLFGSMEVIGVVSWGRGCARPNLPGIYTRI 270

  Fly   305 GSFNDWIAENTRDACSCAQPEAA 327
            .::..||.|...:.|.|...:.|
Mosquito   271 VNYLPWIHEKLANECLCPPKDVA 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 105/229 (46%)
Tryp_SPc 83..314 CDD:238113 106/231 (46%)
AgaP_AGAP004569XP_001237553.3 Tryp_SPc 50..277 CDD:214473 105/229 (46%)
Tryp_SPc 51..280 CDD:238113 106/231 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D19085at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.