DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and MST1

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001380510.1 Gene:MST1 / 4485 HGNCID:7380 Length:737 Species:Homo sapiens


Alignment Length:306 Identity:77/306 - (25%)
Similarity:129/306 - (42%) Gaps:61/306 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TPSLRSASDPEKILNNLAQLRQSSFLDWIQSILGPEVPA-EWSSPAK-RECAECSCG----NINT 79
            ||..|.:      |.::|:       .||..|.|  ||: .|....: ....:.:||    .:..
Human   471 TPQTRCS------LRSVAR-------GWIGWISG--VPSCAWLGAIRATHPGQSACGIGEAQLPV 520

  Fly    80 RHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRL----ITVRLLEH 140
            .||      .|:.:          |..:||.|||.:|:.|||..|.:..:..|    :.:..|..
Human   521 SHR------EELRQ----------GQHFCGGSLVKEQWILTARQCFSSCHMPLTGYEVWLGTLFQ 569

  Fly   141 NRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYA---GQ 202
            |.|.....:....|::::..|.      .|.:.|::....|.|...:..:|:  |.|.|.   |.
Human   570 NPQHGEPSLQRVPVAKMVCGPS------GSQLVLLKLERSVTLNQRVALICL--PPEWYVVPPGT 626

  Fly   203 TAVVTGWGALSEGGPISDTLQEVE-VPILSQEECRNSNYGESKITDNMICA-GYVEQGGKDSCQG 265
            ...:.|||.....|  :||:..|. :.::|.:||...:.|  ::.::.:|. |.:...|  :|:|
Human   627 KCEIAGWGETKGTG--NDTVLNVALLNVISNQECNIKHRG--RVRESEMCTEGLLAPVG--ACEG 685

  Fly   266 DSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311
            |.|||:... :.:.:.|.||:.....||:...|.|:|||..|.|||
Human   686 DYGGPLACF-THNCWVLEGIIIPNRVCARSRWPAVFTRVSVFVDWI 730

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 60/237 (25%)
Tryp_SPc 83..314 CDD:238113 61/238 (26%)
MST1NP_001380510.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.