DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and ctrl

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001004582.1 Gene:ctrl / 447843 ZFINID:ZDB-GENE-040912-147 Length:261 Species:Danio rerio


Alignment Length:267 Identity:99/267 - (37%)
Similarity:141/267 - (52%) Gaps:27/267 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 IQSILGPEVPAEWSSPAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNF-YCGASL 112
            :.|.||..|||  ..|.           |:..:|||.|:......:||.:.|.....| :||.||
Zfish    11 VASTLGCGVPA--IKPV-----------ISGYNRIVNGENAVSGSWPWQVSLQQSNGFHFCGGSL 62

  Fly   113 VNDQYALTAAHC-VNGFYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIR 176
            :|..:.:||||| |...||.:|   |.||:|..|...:..:.:::.:.||.|:::||::||.|::
Zfish    63 INQYWVVTAAHCRVQAGYHYVI---LGEHDRGSSAESVQVKSIAKAITHPYYNSQNFNNDITLLK 124

  Fly   177 FNEPVRLGIDMHPVCMPTPSENY-AGQTAVVTGWGAL-SEGGPISDTLQEVEVPILSQEECRNSN 239
            .:.|.:|...:.|||:...|.:. :|...|.||||.. |...|  ..||:..:|:||..:|: ..
Zfish   125 LSSPAQLTSRISPVCLAASSTSIPSGTRCVTTGWGKTGSTSSP--RILQQTALPLLSPAQCK-QY 186

  Fly   240 YGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRV 304
            :|:::|||.|||||   ..|..|||||||||:....||..||: ||||||........|.||.||
Zfish   187 WGQNRITDAMICAG---ASGVSSCQGDSGGPLVCESSGAWYQV-GIVSWGTSDCNVRTPAVYARV 247

  Fly   305 GSFNDWI 311
            .....||
Zfish   248 SYLRQWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 89/232 (38%)
Tryp_SPc 83..314 CDD:238113 90/233 (39%)
ctrlNP_001004582.1 Tryp_SPc 31..254 CDD:214473 89/232 (38%)
Tryp_SPc 32..257 CDD:238113 90/233 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.