DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP012777

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_001230468.2 Gene:AgaP_AGAP012777 / 4397664 VectorBaseID:AGAP012777 Length:465 Species:Anopheles gambiae


Alignment Length:173 Identity:47/173 - (27%)
Similarity:84/173 - (48%) Gaps:14/173 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 IVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSEN---YAGQTAVVTGWG 210
            :.:..|..:::||.|::..|.:|||||:..|.:.:...:.|||:.|..:|   ..|:|..:.|:|
Mosquito     8 VQEHTVQELIVHPGYNSSRFVNDIALIKLTESITMSEFVQPVCLWTMDKNQELIVGKTGTLVGFG 72

  Fly   211 ALSEGGPISDTLQEVEVPILSQEECRNSN--YGESKITDNMICAGYVEQGGKDSCQGDSGGPMHV 273
             |:|...:|:.|::..:.::....|..|:  ...:::|..|.|.|  .|....:|.|||||.:..
Mosquito    73 -LNEQDVVSEQLKQASIGVVDALTCIKSDRLSFANQLTAEMFCGG--GQSNVSACNGDSGGGLFF 134

  Fly   274 LGSGDAYQLAGIVSW-----GEGCAKPNAPGVYTRVGSFNDWI 311
            ...|..: :.|:||:     ..|...|:....|..|..:..||
Mosquito   135 NVEGKWF-VRGVVSFIPVRQRTGLCDPSKYTAYADVAKYLGWI 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 45/171 (26%)
Tryp_SPc 83..314 CDD:238113 47/173 (27%)
AgaP_AGAP012777XP_001230468.2 Tryp_SPc <1..178 CDD:238113 47/173 (27%)
Tryp_SPc <4..176 CDD:214473 45/171 (26%)
Tryp_SPc 219..458 CDD:214473
Tryp_SPc 219..458 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.