DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP012778

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_001230340.2 Gene:AgaP_AGAP012778 / 4397620 VectorBaseID:AGAP012778 Length:276 Species:Anopheles gambiae


Alignment Length:307 Identity:86/307 - (28%)
Similarity:139/307 - (45%) Gaps:65/307 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PEKILNNLAQLRQSSFLDWIQS------ILGPEVPAEWSSPAKRECAECSCGNINTRHRIVGGQE 88
            |.:..||  .:::.|.||..:|      :|...|.|:..|                 .||:||  
Mosquito     3 PARGKNN--NIKEFSMLDLKRSGVALACLLPLAVQADAGS-----------------QRIIGG-- 46

  Fly    89 TEVHEYPWMIML--MWFGNF--YCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSHVKI 149
            :.|....||:.:  :..||:  :||.:|::.|:.|||||||.......:.|.:...:....|.: 
Mosquito    47 SAVTAPSWMVAVGEVVNGNWSNFCGGTLIDKQWVLTAAHCVANAQSGPMEVAIGVSDLSRPHTR- 110

  Fly   150 VDRRVSRVLIHPKYSTR----------NFDSDIALIRFNEPVRLGIDMHPVCMP--TPSENYAGQ 202
              .:|.:||:||:|...          .:.||:||:....||    ...|:.|.  |..:.:...
Mosquito   111 --SKVDQVLMHPEYYVNLLSNLGYRETPYSSDVALLHLATPV----TQAPIVMADITTKDTWQWN 169

  Fly   203 TAVV--TGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQG 265
            |.::  .|:|.::.....|.. |.:.|.:..:.| |:..||:.  |...|.||  :..|:|:|:|
Mosquito   170 TTMLHAIGYGGINPDATKSSP-QLLAVDLAYRGE-RDYWYGDP--TTTHIFAG--KLAGQDTCKG 228

  Fly   266 DSGGPMHVLGSGDAYQLAGIVSWGE-GCAKPNAPGVYTRVGSFNDWI 311
            |||||:...|     :|.|:.|:|. .||..:|.| ||...:|:|||
Mosquito   229 DSGGPLTYGG-----KLVGVTSYGAFPCATGSAGG-YTYAPAFSDWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 73/247 (30%)
Tryp_SPc 83..314 CDD:238113 74/248 (30%)
AgaP_AGAP012778XP_001230340.2 Tryp_SPc 42..269 CDD:214473 73/247 (30%)
Tryp_SPc 43..269 CDD:238113 72/246 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.