DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and KLK12

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_062544.1 Gene:KLK12 / 43849 HGNCID:6360 Length:254 Species:Homo sapiens


Alignment Length:240 Identity:82/240 - (34%)
Similarity:114/240 - (47%) Gaps:25/240 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSH 146
            :|..|.|...:..||.:.|....:..||..|::.::.||||||....|    .|||.||:.....
Human    21 KIFNGTECGRNSQPWQVGLFEGTSLRCGGVLIDHRWVLTAAHCSGSRY----WVRLGEHSLSQLD 81

  Fly   147 VKIVDRRVSRVLIHPKY--STRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQTAVVTGW 209
            .....|.....:.||.|  ::.:.:.|:.|:|...|||:...:.|:.:|..... ||....|:||
Human    82 WTEQIRHSGFSVTHPGYLGASTSHEHDLRLLRLRLPVRVTSSVQPLPLPNDCAT-AGTECHVSGW 145

  Fly   210 GALSE-GGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHV 273
            |..:. ..|..|.||.:.:.|:|...|.....|  :||.||:|||.|.  |:|:||||||||: |
Human   146 GITNHPRNPFPDLLQCLNLSIVSHATCHGVYPG--RITSNMVCAGGVP--GQDACQGDSGGPL-V 205

  Fly   274 LGSGDAYQLAGIVSWGE--GCAKPNAPGVY------TRVGSFNDW 310
            .|.    .|.|:||||.  .|.:...||||      |.||....|
Human   206 CGG----VLQGLVSWGSVGPCGQDGIPGVYTYICNSTLVGLGTSW 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 82/240 (34%)
Tryp_SPc 83..314 CDD:238113 82/239 (34%)
KLK12NP_062544.1 Tryp_SPc 21..236 CDD:214473 78/228 (34%)
Tryp_SPc 22..236 CDD:238113 78/227 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.