DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and KLK14

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001298111.2 Gene:KLK14 / 43847 HGNCID:6362 Length:251 Species:Homo sapiens


Alignment Length:246 Identity:95/246 - (38%)
Similarity:139/246 - (56%) Gaps:27/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 HRIVGGQETEVHEYPWMIMLMWFG---NFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHN- 141
            ::|:||........||...|: .|   .|.||.:|::.|:.:|||||    ...::.|.|.:|| 
Human    23 NKIIGGHTCTRSSQPWQAALL-AGPRRRFLCGGALLSGQWVITAAHC----GRPILQVALGKHNL 82

  Fly   142 -RQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQTAV 205
             |.::..:::  ||.|.:.||.|::|..|:|:.|::..:|.|:|..:.|:.: |.:....|.:..
Human    83 RRWEATQQVL--RVVRQVTHPNYNSRTHDNDLMLLQLQQPARIGRAVRPIEV-TQACASPGTSCR 144

  Fly   206 VTGWGALSEGGPIS---DTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDS 267
            |:|||.:|  .||:   .:||.|.:.|...|.|:.: |..: ||..|:||| |.|||||||||||
Human   145 VSGWGTIS--SPIARYPASLQCVNINISPDEVCQKA-YPRT-ITPGMVCAG-VPQGGKDSCQGDS 204

  Fly   268 GGPMHVLGSGDAYQLAGIVSWG-EGCAKPNAPGVYTRVGSFNDWIAENTRD 317
            |||:...|     ||.|:|||| |.||.|..|||||.:..:..||.|..||
Human   205 GGPLVCRG-----QLQGLVSWGMERCALPGYPGVYTNLCKYRSWIEETMRD 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 90/237 (38%)
Tryp_SPc 83..314 CDD:238113 92/239 (38%)
KLK14NP_001298111.2 Tryp_SPc 25..247 CDD:238113 92/239 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.