DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Gm5771

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001034086.1 Gene:Gm5771 / 436523 MGIID:3646222 Length:245 Species:Mus musculus


Alignment Length:238 Identity:98/238 - (41%)
Similarity:142/238 - (59%) Gaps:25/238 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSH 146
            :||||.....:..|:.:.|. .|..:||.||:|||:.::||||    |...|.|||.|||     
Mouse    22 KIVGGYTCRENSVPYQVSLN-SGYHFCGGSLINDQWVVSAAHC----YKTRIQVRLGEHN----- 76

  Fly   147 VKIVDR-----RVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQTAVV 206
            :|:::.     ..::::.||.::.:..::||.||:.:.||.|...:..|.:|: |...||...::
Mouse    77 IKVLEGNEQFVNAAKIIKHPNFNRKTLNNDIMLIKLSSPVTLNARVATVALPS-SCAPAGTQCLI 140

  Fly   207 TGWG-ALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGP 270
            :||| .||.|....|.||.::.|:|.|.:|..|..|  |||.||:|||::| |||||||||||||
Mouse   141 SGWGNTLSFGVSEPDLLQCLDAPLLPQADCEASYPG--KITGNMVCAGFLE-GGKDSCQGDSGGP 202

  Fly   271 MHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAE 313
            :...|     :|.||||||.|||..:.|||||:|.::.|||.:
Mouse   203 VVCNG-----ELQGIVSWGYGCALADNPGVYTKVCNYVDWIQD 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 96/234 (41%)
Tryp_SPc 83..314 CDD:238113 98/237 (41%)
Gm5771NP_001034086.1 Tryp_SPc 22..238 CDD:214473 96/234 (41%)
Tryp_SPc 23..241 CDD:238113 98/237 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.