DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Try10

DIOPT Version :10

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001034085.1 Gene:Try10 / 436522 MGIID:3687012 Length:246 Species:Mus musculus


Alignment Length:102 Identity:21/102 - (20%)
Similarity:31/102 - (30%) Gaps:47/102 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   425 SRQPSP-AEEQLPRPNMLDPTGVHGSGFPQHPSLHNMLGSAAPGGNDVTQQAAAAALGSYHPQMI 488
            :.||.| ...::.|..:.:||              |.:.:|..|..|:                 
Mouse    13 AEQPQPKRRRRIDRSMIGEPT--------------NFVHTAHVGSGDL----------------- 46

  Fly   489 NQMGQMGQLGQMNPMNQLNQLNQLNQMQSHVMNGVGG 525
                       ...||.:|.:.  |||||  ..|.||
Mouse    47 -----------FTGMNSVNSIQ--NQMQS--KGGYGG 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 83..314 CDD:238113
Try10NP_001034085.1 Tryp_SPc 24..242 CDD:238113 18/91 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.