DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG11313

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:372 Identity:113/372 - (30%)
Similarity:165/372 - (44%) Gaps:75/372 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLILATALGD-LACATPSLRSA-----------------SDPEKILNNLAQLRQSSFLDWIQSIL 53
            |||:.||.|. ::|..|:.|:.                 |:|..  :.:..:|:|..|...||.|
  Fly    11 LLIIRTAHGQYVSCRNPNQRTGYCVNIPLCVPLNSVLAKSNPTD--SEMRFIRESRCLVSDQSDL 73

  Fly    54 GPEV----PAEWSSPAKRECAE----------CSCGNINTRHRIVGGQETEVHEYPWMIMLMWFG 104
             |.|    ..::::...|...|          ..||.....::|..|.||.:.|:.||::|.:..
  Fly    74 -PFVCCTPDTDYNTTRARPNDEVIHSTLLPDRSICGGDIAYNQITKGNETVLTEFAWMVLLEYRP 137

  Fly   105 N------FYCGASLVNDQYALTAAHCVN-------GFYHRLITVRLLEHNRQDSHVKIVD----- 151
            :      .||..||:|::|.:||||||:       |.....::|||.|||..    .:||     
  Fly   138 HDGQQLRTYCAGSLINNRYVVTAAHCVSAATRARKGDVSFRVSVRLGEHNTS----AVVDCLNGR 198

  Fly   152 -------RRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTP--SENY-AGQTAVV 206
                   ..|..:.||..:.||.|.:||||||....|.....:.|||:|:.  .:|: :||...|
  Fly   199 CLPEPVQIAVEEIRIHESFGTRLFWNDIALIRLAREVAYSPSIRPVCLPSTVGLQNWQSGQAFTV 263

  Fly   207 TGWG--ALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGG 269
            .|||  ..||..|:.   .::.|..:....||........:.|:.:||....:|  |||.|||||
  Fly   264 AGWGRTLTSESSPVK---MKLRVTYVEPGLCRRKYASIVVLGDSHLCAEGRSRG--DSCDGDSGG 323

  Fly   270 PMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTR 316
            |:.....| .:.|.||||:|..|.....|.|||.|.|:..||.:|.|
  Fly   324 PLMAFHEG-VWVLGGIVSFGLNCGSRFWPAVYTNVLSYETWITQNIR 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 86/258 (33%)
Tryp_SPc 83..314 CDD:238113 88/260 (34%)
CG11313NP_651821.3 CLIP 24..78 CDD:288855 13/56 (23%)
Tryp_SPc 116..367 CDD:238113 88/260 (34%)
Tryp_SPc 116..364 CDD:214473 86/257 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457383
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.