DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG9733

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:307 Identity:105/307 - (34%)
Similarity:155/307 - (50%) Gaps:56/307 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RQSSFLDWIQSILGPEVPAEWSSPAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMW--- 102
            |:||..|  .|.|.|:.|              |||.:..|:||..||:|:|:|:|||::|.:   
  Fly   136 RKSSTSD--GSSLLPQPP--------------SCGGVGIRNRIYDGQDTDVNEFPWMVLLEYRRR 184

  Fly   103 FGN---FYCGASLVNDQYALTAAHCVNGFYHR----LITVRLLEHNRQDSHVKIVD--------- 151
            .||   ..|..||:|.:|.||||||:.|...|    |::|||.||:.:.:    ||         
  Fly   185 SGNGLSTACAGSLINRRYVLTAAHCLTGRIEREVGTLVSVRLGEHDTRTA----VDCPPGGGSCS 245

  Fly   152 ---RRV--SRVLIHPKYSTR--NFDSDIALIRFNEPVRLGIDMHPVCMPTP---SENYAGQTAVV 206
               :|:  ..:.:|.:||.:  |...||.|||....||...::.|:|:|:.   ....:||...|
  Fly   246 PEVQRLGFEEIRVHERYSEKASNQVHDIGLIRMERNVRYSDNIQPICLPSSVGLESRQSGQQFTV 310

  Fly   207 TGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKIT--DNMICAGYVEQGGKDSCQGDSGG 269
            .|||...:... |...|:|.|..:...:|| ..:.:.|:.  ...:|||  .|..||||.|||||
  Fly   311 AGWGRTLKMAR-SAVKQKVTVNYVDPAKCR-QRFSQIKVNLEPTQLCAG--GQFRKDSCDGDSGG 371

  Fly   270 PMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTR 316
            |: :....:::.|.||||:|..|...:.|||||.|.:::.||.:|.|
  Fly   372 PL-MRFRDESWVLEGIVSFGYKCGLKDWPGVYTNVAAYDIWIRQNVR 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 89/259 (34%)
Tryp_SPc 83..314 CDD:238113 90/261 (34%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 89/259 (34%)
Tryp_SPc 162..415 CDD:238113 90/261 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457371
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.