DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG9737

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:287 Identity:90/287 - (31%)
Similarity:139/287 - (48%) Gaps:50/287 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 CGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFY-CGASLVNDQYALTAAHCVNGFYHR----LI 133
            ||. ...:||.||:..|:.|:||:.:|::..|.| |..:|::|::.|||||||.|...|    |.
  Fly   142 CGK-QVTNRIYGGEIAELDEFPWLALLVYNSNDYGCSGALIDDRHILTAAHCVQGEGVRDRQGLK 205

  Fly   134 TVRLLEHN--------RQDSHVKIVDRRV----SRVLIHPKYST-RNFD-SDIALIRFNEPVRLG 184
            .|||.|.|        .:.:::...|..:    .::.:||:|.. .|:. :|||:||...||...
  Fly   206 HVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFT 270

  Fly   185 IDMHPVCMPTPSENYA---GQTAVVTGWGA--------LSEGGPISDTLQEVEVPILSQEECRN- 237
            ..:.|:|:|..||...   ||...|:|||.        ::...||.   .::.:|.:|.|.|.. 
  Fly   271 HFVMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIK---LKLRIPYVSNENCTKI 332

  Fly   238 -SNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLA-GIVSWG-EGCAKPNAPG 299
             ..:| .::....||||  .:..||:|.||||||:.......:..:| |:||:| ..|.....|.
  Fly   333 LEGFG-VRLGPKQICAG--GEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKPA 394

  Fly   300 VYTRVGSFNDWI---------AENTRD 317
            |||.|..:.|||         ::.|:|
  Fly   395 VYTNVAEYTDWIDSVVQQRKKSQQTQD 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 84/262 (32%)
Tryp_SPc 83..314 CDD:238113 85/273 (31%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 84/262 (32%)
Tryp_SPc 150..409 CDD:238113 85/264 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457531
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.840

Return to query results.
Submit another query.