DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001025468.1 Gene:Tmprss11c / 435845 MGIID:3521861 Length:431 Species:Mus musculus


Alignment Length:264 Identity:93/264 - (35%)
Similarity:134/264 - (50%) Gaps:24/264 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 PAKRECAECSCGN---INTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCV 125
            |...:.....||.   |:..|::.|||:.|..|:||...|.......|||:|:::.:.:|||||.
Mouse   178 PIAEDLLNTCCGRRTIIHRGHKVAGGQDAEEGEWPWQASLQQNSVHRCGATLISNYWLITAAHCF 242

  Fly   126 NGFYHRLITVRLLEHNRQDSHVKI--------VDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVR 182
                       :...|.:|..|..        ..|.|..::||..||....|:|||::|.:.||.
Mouse   243 -----------IRAANPKDWKVSFGFLLSKPQAPRAVKNIIIHENYSYPAHDNDIAVVRLSSPVL 296

  Fly   183 LGIDMHPVCMPTPSENY-AGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKIT 246
            ...::...|:|..::.: .....||||||.|...|...:.||:.:|.|:..:.|.:.......||
Mouse   297 YESNIRRACLPEATQKFPPNSDVVVTGWGTLKSDGDSPNILQKGKVKIIDNKTCNSGKAYGGMIT 361

  Fly   247 DNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311
            ..|:|||:: :|..|:||||||||:....|...:.||||||||:.||.||.|||||||..:.|||
Mouse   362 PGMMCAGFL-KGRVDACQGDSGGPLVSEDSKGIWFLAGIVSWGDECALPNKPGVYTRVTYYRDWI 425

  Fly   312 AENT 315
            ...|
Mouse   426 TSKT 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 85/237 (36%)
Tryp_SPc 83..314 CDD:238113 87/239 (36%)
Tmprss11cNP_001025468.1 SEA 62..157 CDD:279699
Tryp_SPc 199..425 CDD:214473 85/237 (36%)
Tryp_SPc 200..428 CDD:238113 87/239 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I3995
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.