DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and aqrs

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster


Alignment Length:241 Identity:45/241 - (18%)
Similarity:84/241 - (34%) Gaps:52/241 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 GNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSHVKIVDRRVSRVLI---HPKYST 165
            |:..|..:|::.:..:|:.||.......||.....:|....:.|::.|......:|   .|....
  Fly    85 GSVICAGALISRRMVVTSTHCFQPRRFDLIYEYTAKHLSILTGVELDDNPEPHQVIGFFMPVNKN 149

  Fly   166 RNFDSDIALIRFNEPVRLGIDMH---PVCMPTPSENYAGQTAVVTGWGALSEGGPISDTLQEVEV 227
            ..|.:.:||:..:.  :|..|.:   |:....|.   ||....:..:      ||....::....
  Fly   150 ERFTNYVALLALSN--KLDRDKYRYIPLHRKKPQ---AGDDVKMAYY------GPPKFQIRLYNT 203

  Fly   228 PILSQEECRNSNYG------ESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIV 286
            .::..:.|: .:||      .|....:.||........|.:|....|.|:.:     ..:||.|.
  Fly   204 RVMDIDRCK-IHYGLKEVFHVSTFEPDFICVRNKRHSKKTTCSTRPGDPLLI-----DNKLAAIN 262

  Fly   287 SWGEGC--------------AKPNAPGV---------YTRVGSFND 309
            .:||.|              .:|..|.:         :|..|.:|:
  Fly   263 IYGEHCDEDDDSTNMDIYLPIRPVIPFIQTATDALRAFTGSGPYNE 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 45/241 (19%)
Tryp_SPc 83..314 CDD:238113 45/241 (19%)
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 42/221 (19%)
Tryp_SPc 83..268 CDD:304450 39/199 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.