DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG5909

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster


Alignment Length:385 Identity:101/385 - (26%)
Similarity:159/385 - (41%) Gaps:91/385 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ATALGDLACATPSL----RSASDPEKILNNLAQLRQSSFLDWIQSILG----------------- 54
            |..||.|.|..|.|    .|...|.:......:.::..|   :|.|||                 
  Fly     5 AIRLGLLLCILPQLVISQSSCVTPAQAAGQCIRYQECPF---VQKILGIYGRNIPRKIHNQISEM 66

  Fly    55 ----------------PEVPAEWSSPAKRECAECSCGNINTRHR-------------------IV 84
                            .|.|.:.:..::|:......||:|...|                   :.
  Fly    67 QCRSTTNTRDFHLCCPNEAPPQSNQESQRKVVRSEGGNLNRYDRQGLQLLNSVTNCGNKGNPKVS 131

  Fly    85 GGQETEVHEYPWMIMLMWFGN----FYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEH---NR 142
            ||:.....::||:.:|.:..|    |.||.||:::::.||||||:.. ...:|.|||.||   :.
  Fly   132 GGKTARPGDFPWVALLKYKINDPRPFRCGGSLISERHILTAAHCIID-QPEVIAVRLGEHDLESE 195

  Fly   143 QDSHVKIVDRRV----------SRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSE 197
            :|.|......||          .::.:||.|.......|:|:|:.:..|:....:.|||:|...:
  Fly   196 EDCHYLGGTNRVCIPPYEEYGIEQIRVHPNYVHGKISHDVAIIKLDRVVKEKSHIKPVCLPIDQK 260

  Fly   198 NYA---GQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGG 259
            :..   .|:..|.|||. :|...::..||:..:...|..||| ..|.:.:::||.|||  ...|.
  Fly   261 SQELDFDQSFFVAGWGG-TEKETVATKLQQALITRKSLNECR-QYYNKGEVSDNHICA--TGTGI 321

  Fly   260 KDSCQGDSGGPM---HVLGSGDAYQLA--GIVSWGEGCAKPNAPGVYTRVGSFNDWIAEN 314
            |.:||||||||:   |..  .:.|::.  |:||:|......|.|||:..|.....||.:|
  Fly   322 KHTCQGDSGGPVFFKHRF--KNTYRVVQYGVVSFGGRLCGQNQPGVFASVIDMLPWITQN 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 78/272 (29%)
Tryp_SPc 83..314 CDD:238113 79/255 (31%)
CG5909NP_651544.1 CLIP 25..82 CDD:197829 6/59 (10%)
Tryp_SPc 129..376 CDD:214473 77/253 (30%)
Tryp_SPc 132..379 CDD:238113 79/253 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.920

Return to query results.
Submit another query.