DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Tmprss9

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_006513905.2 Gene:Tmprss9 / 432478 MGIID:3612246 Length:1342 Species:Mus musculus


Alignment Length:300 Identity:110/300 - (36%)
Similarity:152/300 - (50%) Gaps:22/300 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 AECSCG---NINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYH- 130
            |:|.||   ...:..|||||.|....|:||.:.|......:|||:::..::.::||||.|.|.. 
Mouse   440 AQCDCGWQPAWRSAGRIVGGVEAAPGEFPWQVSLRENHEHFCGATIIGARWLVSAAHCFNEFQDP 504

  Fly   131 -----RLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPV 190
                 :..:|.|     ..|....|..||.|:..||.|.....|.|:|::....|:..|..:.|.
Mouse   505 AQWAAQAGSVHL-----SGSEASAVRTRVLRIAKHPAYDADTADFDVAVLELARPLPFGRYVQPA 564

  Fly   191 CMPTPSENY-AGQTAVVTGWGALSEGGPIS-DTLQEVEVPILSQEECRNSNYGESKITDNMICAG 253
            |:|..:..: .|:..:::|||.|.|...:. :.||:..|.:|.|..| :|.||.| :||.|:|||
Mouse   565 CLPAATHVFPPGKKCLISGWGYLKEDFLVKPEVLQKATVELLDQSLC-SSLYGHS-LTDRMVCAG 627

  Fly   254 YVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTRDA 318
            |:: |..||||||||||:........:.||||||||.|||:...|||||||....|||.|.|..|
Mouse   628 YLD-GKVDSCQGDSGGPLVCEEPSGRFFLAGIVSWGIGCAEARRPGVYTRVTRLRDWILEVTSAA 691

  Fly   319 CSCAQPEAAGEPA---SPMETTEQGDQENTTANGAAEADP 355
            .....|.|...||   :|..|:.:....||.|...|...|
Mouse   692 DMPVVPTATPAPATPSTPWPTSPESWAPNTFAKPTAAPSP 731

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 90/236 (38%)
Tryp_SPc 83..314 CDD:238113 91/238 (38%)
Tmprss9XP_006513905.2 SEA 285..365 CDD:366610
LDLa 407..442 CDD:238060 1/1 (100%)
Tryp_SPc 455..684 CDD:214473 90/236 (38%)
Tryp_SPc 756..984 CDD:214473
Tryp_SPc 1085..1336 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.