DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG11836

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:268 Identity:106/268 - (39%)
Similarity:159/268 - (59%) Gaps:5/268 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 EVPAEWSSPAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALT 120
            |...|::..:..:..:|.||..|...|||||:.|.|::||||..:::.|.|:||.||:...|.|:
  Fly    70 EDEVEYTENSSLKNCDCDCGFSNEEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLS 134

  Fly   121 AAHCVNGFYHRLITVRLLEHNRQ-DSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLG 184
            |||||.......|.|...:|::: .|..:.:.|.|:.|:.|..:....:::||||:|..:|:...
  Fly   135 AAHCVKKLRKSKIRVIFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFS 199

  Fly   185 IDMHPVCMPTPSENYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNM 249
            ..:.|:|:|..:.:.||:...|.|||..||||.:...:.:|:|||:|..||||..|..::||.:|
  Fly   200 KIIKPICLPRYNYDPAGRIGTVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSM 264

  Fly   250 ICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAEN 314
            :|||   :...||||||||||: :|.:|..|.:.||||||.||.:...||||:||..|..||..|
  Fly   265 LCAG---RPSMDSCQGDSGGPL-LLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSN 325

  Fly   315 TRDACSCA 322
            ..:.|.|:
  Fly   326 LENTCLCS 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 95/229 (41%)
Tryp_SPc 83..314 CDD:238113 96/231 (42%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 96/231 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471772
Domainoid 1 1.000 147 1.000 Domainoid score I2768
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I2933
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D19085at50557
OrthoFinder 1 1.000 - - FOG0001240
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 1 0.900 - - OOG6_100031
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
109.900

Return to query results.
Submit another query.