DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG31219

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:276 Identity:88/276 - (31%)
Similarity:133/276 - (48%) Gaps:54/276 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 CGNINTRHRIVGGQETEVHEYPWMIMLMWFGNF------YCGASLVNDQYALTAAHCVNGFYH-- 130
            ||...:.:|:|||.|...:.||||.||::....      :|..||:|::|.||:||||||...  
  Fly    80 CGQSLSTYRMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNGIPRDL 144

  Fly   131 RLITVRLLEHN------------RQDSHVKI--VDRRVSRVLIHPKYST---RNFDSDIALIRFN 178
            .|.:|||.||:            .||:...:  ::.::.::::|..:|:   ||.:.||||:|..
  Fly   145 SLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIALLRLK 209

  Fly   179 EPVRLGIDMHPVCMPTPSENYAGQTAVVTGWGALSEGGPISDTLQE------------VEVPILS 231
            .|||....:.|:|:|... .:|.....:.|||..:| |..|..|..            :..|.|.
  Fly   210 MPVRYRTGIMPICIPKHG-FFAKSKLEIAGWGKTNE-GQFSQVLMHGFIRERSIAVCALRFPYLD 272

  Fly   232 QEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWG-EGCAKP 295
            ..:            ...||||..:  |.|:||||||||:.|.....:..||||.::| :.|.:.
  Fly   273 LNQ------------SLQICAGGYD--GVDTCQGDSGGPLMVTMDNSSVYLAGITTYGSKNCGQI 323

  Fly   296 NAPGVYTRVGSFNDWI 311
            ..||:|||..:|..||
  Fly   324 GIPGIYTRTSAFLPWI 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 84/266 (32%)
Tryp_SPc 83..314 CDD:238113 85/267 (32%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 84/266 (32%)
Tryp_SPc 90..342 CDD:238113 85/266 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.