DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG7142

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster


Alignment Length:261 Identity:72/261 - (27%)
Similarity:112/261 - (42%) Gaps:47/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMWFGN-----FYCGASLVNDQYALTAAHCVNGFYHRLITVRLLE-- 139
            :.:..:|...|..|:::.:.....     .||..:::|:.:.||||||       |.:.:.:|  
  Fly    79 KFLAKREATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHC-------LSSPQAVENS 136

  Fly   140 ---------HNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTP 195
                     |:::.....|..|.:...:.|..|.......|||||...||:.....:.|..:|. 
  Fly   137 VIVAGSHDIHDQKGEASNIQMRHIDYYVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATLPE- 200

  Fly   196 SENYAGQTAVVTGWGALSEGGPISDT--------LQEVEVPILSQEECRN--SNYGESKITDNMI 250
                  |.|...|:|.|...|.:|.|        |||..:|||..|.|..  :..| ..:.:..:
  Fly   201 ------QDAQPEGYGTLYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSG-LPLHETNL 258

  Fly   251 CAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLA----GIVSWGE-GCAKPNAPGVYTRVGSFNDW 310
            |.|.: .||...|..|||||:......:.::.|    ||||||: .|.:.|||.|:.||.:|.:|
  Fly   259 CTGPL-TGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEW 322

  Fly   311 I 311
            |
  Fly   323 I 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 70/259 (27%)
Tryp_SPc 83..314 CDD:238113 72/260 (28%)
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 72/256 (28%)
Tryp_SPc 84..323 CDD:214473 70/254 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.