DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG31266

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:331 Identity:75/331 - (22%)
Similarity:129/331 - (38%) Gaps:65/331 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FHLLLILATALGDLACATPSLRSASDPEKILNNLAQLRQSSFLDWIQSILGPEVPAEWSSPAKRE 68
            ::|.::|...|..|...|.::|...:|...|.|:.:.|.:.           .||          
  Fly     5 WNLTVLLGLTLLALQGPTEAMRMRGEPLPGLANIERHRSTE-----------AVP---------- 48

  Fly    69 CAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFY----CGASLVNDQYALTAAHCVNGFY 129
                       :.|::||.......:||:..:.   |.|    |||.::::.:.||||.||.|. 
  Fly    49 -----------QGRVIGGTTAAEGNWPWIASIQ---NAYSYHLCGAIILDETWVLTAASCVAGL- 98

  Fly   130 HRLITVRLLEHNRQDSHVKIVD--------RRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGID 186
             |.:.:.::        ...||        ..||::.:|..:....:.:||||::.:..:.....
  Fly    99 -RPLNLLVV--------TGTVDWWDLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDV 154

  Fly   187 MHPVCMPTPSENYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMIC 251
            ...:.:....|...|......|||:....|.....|||.....|..:.||.....:..:....:|
  Fly   155 TKNITLADIDELEEGDKLTFAGWGSSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVC 219

  Fly   252 AGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTR 316
            ...  ..|:.:|.||:|||:    ..:..:|.||.:||..|.: ..|.||.|...::||| ..|.
  Fly   220 VQM--DAGQGACHGDTGGPL----IDEQQRLVGIGNWGVPCGR-GYPDVYARTAFYHDWI-RTTM 276

  Fly   317 DACSCA 322
            :.|:.|
  Fly   277 NGCTIA 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 58/240 (24%)
Tryp_SPc 83..314 CDD:238113 59/242 (24%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 58/240 (24%)
Tryp_SPc 52..275 CDD:238113 59/243 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.