DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG14892

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster


Alignment Length:432 Identity:98/432 - (22%)
Similarity:153/432 - (35%) Gaps:153/432 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PSLRSASDPEKILNNLAQLR--------QSSFLDWIQSILGPEVPAEWSSPAKREC-AECSCGNI 77
            |..|..|.|:....:|:|.:        .::.|.|:..:|        ..|:.|:. .:|.|...
  Fly    19 PKSRLQSRPQSRSQSLSQSQCHWQIPATSTATLSWLCLLL--------LLPSSRQFETDCGCRPA 75

  Fly    78 NTRHRIVGGQETEVHEYPWMIML------MWFGNFYCGASLVNDQYALTAAHCV-NGFYH----R 131
            ....||:.|..|...::||...|      :.|...:|||.|::..:.|:||||| |..::    .
  Fly    76 RRGPRIIAGAATNEGQFPWQASLELLHPSLGFLGHWCGAVLIHQYWILSAAHCVHNDLFNLPIPP 140

  Fly   132 LITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRL--GIDMHPVCMP- 193
            |.||.|.||:|...........|.::::|.:|  .||..|:.|::.::|..|  ..::..:|:| 
  Fly   141 LWTVVLGEHDRDVESGNEQRIPVEKIVMHHRY--HNFKHDVVLMKLSKPADLTRASNIRRICLPF 203

  Fly   194 ---------------TPS------------------------------ENYAGQTA--------- 204
                           .||                              ..|...||         
  Fly   204 LLAESPDQAQSETVSPPSSADEDVLIQQLELEDVPEKIDNFLRSVQSRRRYRNVTAPSMKELMNM 268

  Fly   205 ------------------------------------------------------------VVTGW 209
                                                                        |.|||
  Fly   269 KILSRMRQALAQRSPRSHKRSRRRNDKLMKLGPRRDSDDSAEQKHPKVSDEPKEIAFVDCVATGW 333

  Fly   210 GALSEGGPISDTLQEVEVPILSQEECRNSNYGE-SKITDNMICAGYVE-QGGKDSCQGDSGGPMH 272
            |..:..|.:|:.|.:.:||:.....||:: ||. ..|....:|||.:. :||  :|.||||||:.
  Fly   334 GKANISGDLSNQLLKTQVPLHQNGRCRDA-YGSFVNIHGGHLCAGKLNGEGG--TCVGDSGGPLQ 395

  Fly   273 VLGSGDA-YQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAE 313
            ...|.|. :.|.|:.|:|.|||....|.||||...:..||.:
  Fly   396 CRLSRDGPWILVGVTSFGSGCALEGFPDVYTRTSYYMKWIED 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 83/359 (23%)
Tryp_SPc 83..314 CDD:238113 84/362 (23%)
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 83/359 (23%)
Tryp_SPc 81..438 CDD:238113 84/362 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.