DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Sb

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster


Alignment Length:267 Identity:105/267 - (39%)
Similarity:152/267 - (56%) Gaps:18/267 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 SPAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIML---MWFG---NFYCGASLVNDQYALTA 121
            |.|:.||...:.....|  |||||:......:||.:.:   .:||   ...||.:|:|:.:..||
  Fly   526 SAARSECGVPTLARPET--RIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALINENWIATA 588

  Fly   122 AHCVNGFYHRLITVRLLEHNRQDSHVK----IVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVR 182
            .|||:......|.:|:.|::  .|||:    .::|.|::.::|||||...::.|:||::..:|:.
  Fly   589 GHCVDDLLISQIRIRVGEYD--FSHVQEQLPYIERGVAKKVVHPKYSFLTYEYDLALVKLEQPLE 651

  Fly   183 LGIDMHPVCMPTPSENYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRN--SNYGESK- 244
            ....:.|:|:|.......|..|.|||||.|||||.:...||||.|||:|.:.|::  ...|..: 
  Fly   652 FAPHVSPICLPETDSLLIGMNATVTGWGRLSEGGTLPSVLQEVSVPIVSNDNCKSMFMRAGRQEF 716

  Fly   245 ITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFND 309
            |.|..:|||| |.||:||||||||||:........:.||||:|||.|||:.|.|||.||:..|..
  Fly   717 IPDIFLCAGY-ETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAEANLPGVCTRISKFTP 780

  Fly   310 WIAENTR 316
            ||.|:.|
  Fly   781 WILEHVR 787

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 96/241 (40%)
Tryp_SPc 83..314 CDD:238113 97/243 (40%)
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 96/241 (40%)
Tryp_SPc 544..785 CDD:238113 97/243 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 147 1.000 Domainoid score I2768
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.