DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG3505

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:353 Identity:97/353 - (27%)
Similarity:157/353 - (44%) Gaps:77/353 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 CNFHLLLILATALGDLACATPSLRSASDPEKILNNLAQLRQSSFLDWIQSILG------PEVPAE 60
            |::.:.::|:   |:|        |.||...:.:|...:|.:.......|..|      |.:|::
  Fly    46 CDYFMRILLS---GNL--------SQSDRNLLRDNQCGVRGNDVQVCCPSTAGLGALTHPLLPSD 99

  Fly    61 WSSPAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWF-GN----FYCGASLVNDQYALT 120
                         ||.:  |.:.....:|.:.|:||:.::.:. ||    ..||..|::|:|.||
  Fly   100 -------------CGKV--RWQRSNDTDTRIREFPWLALIEYTRGNQEKIHACGGVLISDRYVLT 149

  Fly   121 AAHCV------NGFYHRLITVRLLEHN---------RQDSHV-----KIVDRRVSRVLIHPKY-- 163
            |||||      |   .::..|||.|.:         .:||.|     ...|..:..:|.||.|  
  Fly   150 AAHCVAQAATSN---LQITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQDIAIEELLPHPLYNR 211

  Fly   164 STRNFDSDIALIRFNEPVRLGIDMHPVCMPTP---SENYAGQTAVVTGWGALSEGGPISDTLQEV 225
            :.|...:||||:|...|.:|...:.|:|:|..   ::........|.||.|.|     |..:::.
  Fly   212 TDRTQINDIALVRLASPAKLNDFVQPICLPNKQLRADELEDLVTEVAGWQASS-----SQRMRKG 271

  Fly   226 EVPILSQEECRNSNYGES-KITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWG 289
            .|.|.|.|||:.....:. :|..:.:|.    ......|.|::|||: :|...|.|.|.|:||:|
  Fly   272 YVTISSIEECQRKYASQQLRIQASKLCG----LTNSQECYGNAGGPL-MLFKNDGYLLGGLVSFG 331

  Fly   290 E-GCAKPNAPGVYTRVGSFNDWIAENTR 316
            . .|..|:.|.|||||.|:.|||.::.:
  Fly   332 PVPCPNPDWPDVYTRVASYIDWIHDSLK 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 79/260 (30%)
Tryp_SPc 83..314 CDD:238113 81/262 (31%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855 9/46 (20%)
Tryp_SPc 111..356 CDD:238113 81/257 (32%)
Tryp_SPc 111..354 CDD:214473 79/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.