DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG8870

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:271 Identity:86/271 - (31%)
Similarity:134/271 - (49%) Gaps:41/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNF---------YCGASLVNDQYALTAAHCVN-- 126
            :||  .:|.:...|:...::|:|||.||: :||.         .||.||:|:.|.|||||||.  
  Fly    76 TCG--QSRRKPTKGKIPALNEFPWMAMLL-YGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYP 137

  Fly   127 --GFYHRLITVRLLEHNRQDSHVK-IVDRR-----------VSRVLIHPKYST-RNFDSDIALIR 176
              .:.:.|.||||.|||...:..: ||:.|           |.:::.|.:::. |...:||||:|
  Fly   138 FMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLINDIALVR 202

  Fly   177 FNEPVRLGIDMHPVCMPTPSENYAGQTAV-VTGWGALSEGGPISDTLQEVEVPILSQEECRNSNY 240
            ...|||....:.|:|:|...:..|.:... .:||..:.: |..|:.|....:.....:.|: |||
  Fly   203 LKFPVRYTRAIQPICLPRAQKLAAHKRKFQASGWPDMGQ-GIASEVLLRSFIAERHPDVCK-SNY 265

  Fly   241 GESKITDNMICAGYVEQGGKDSCQGDSGGPMH---VLGSGDAYQLAGIVSWGE-GCA-KPNAPGV 300
            ..:  ..:.||||.::  |.|:..||||||:.   :.|.......|||:|:|: .|. |...|..
  Fly   266 DFN--LGSQICAGGLD--GNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYGQKPCVLKTCKPAF 326

  Fly   301 YTRVGSFNDWI 311
            ||:...|.:||
  Fly   327 YTKTSYFFEWI 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 81/260 (31%)
Tryp_SPc 83..314 CDD:238113 83/261 (32%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 82/252 (33%)
Tryp_SPc 93..337 CDD:214473 80/250 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.