DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG11670

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster


Alignment Length:288 Identity:86/288 - (29%)
Similarity:130/288 - (45%) Gaps:68/288 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 INTRHRIVGGQ-----ETE-VH------------EYPWMIMLMWFGN------FYCGASLVNDQY 117
            :||..::.|..     ||| :|            :||.|..| .|.|      :.||.||:::::
  Fly   146 LNTESKVDGENYNKTAETEDLHDDFNGRSIVAPGQYPHMAAL-GFRNENHEIDYKCGGSLISEEF 209

  Fly   118 ALTAAHCVNGFYHRLITVRLLEHNRQDSHVKIVD--------------RRVSRVLIHPKYSTRNF 168
            .||||||            |..|......|||.|              |||:::.:||.|:....
  Fly   210 VLTAAHC------------LTTHGTSPDIVKIGDIKLKEWELNVAPQRRRVAQIYLHPLYNASLN 262

  Fly   169 DSDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQE 233
            ..||.||:.|.||.....:.||.:...::...|:...: |:|:.....|.::.|.|:::.::..|
  Fly   263 YHDIGLIQLNRPVEYTWFVRPVRLWPMNDIPYGKLHTM-GYGSTGFAQPQTNILTELDLSVVPIE 326

  Fly   234 ECRNSNYGES----KITDNMICAGYVEQGGKDSCQGDSGGPM----------HVLGSGDAYQLAG 284
            :|.:|...:.    .:..:.|||...|: .:|:||||||||:          |.......|.|.|
  Fly   327 QCNSSLPADEGSPHGLLTSQICAHDYEK-NRDTCQGDSGGPLQLNLERRRRRHTSRKHYRYYLVG 390

  Fly   285 IVSWGEGCAKPNAPGVYTRVGSFNDWIA 312
            |.|:|..| :...|||||||.|:.||||
  Fly   391 ITSYGAYC-RSELPGVYTRVSSYIDWIA 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 81/280 (29%)
Tryp_SPc 83..314 CDD:238113 84/282 (30%)
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 79/262 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.