DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG10041

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster


Alignment Length:248 Identity:61/248 - (24%)
Similarity:110/248 - (44%) Gaps:59/248 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 YPWMIM----LMWFGNFYCGASLVNDQYALTAAHCVN----------GFYHRLITVRLLEHNRQD 144
            ||:::.    |..:....|...::::::.|:||||:.          |....|       ::|:.
  Fly    50 YPYIVSIGENLKGYYKHLCVGVILSNEFVLSAAHCIQTNPTKQLYVAGGADSL-------NSRKQ 107

  Fly   145 SHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFN-----EPVRLGIDMHPVCMPTPSENYAGQ-- 202
            :...:|:||     .||::.... .:|||::|..     :.||.           .|.|:||:  
  Fly   108 TRFFVVERR-----WHPQFRVLG-GNDIAVLRIYPKFPLDDVRF-----------RSINFAGKPQ 155

  Fly   203 -----TAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSN-YGESKITDNMICAGYVEQGGKD 261
                 .|.:.|||.:..|.  ...|||:....:..:||:.|: :...|..|  |||.:: :|.:.
  Fly   156 RDSGTQASLVGWGRVGVGK--IRKLQEMPFLTMENDECQQSHRFVFLKPLD--ICAMHL-KGPRG 215

  Fly   262 SCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAEN 314
            .|.||||.|:..:.....|   |::|:|.....|..|..:||:.:::.||.|:
  Fly   216 PCDGDSGAPLMNVAKEKLY---GLLSYGRKACTPLKPYAFTRINAYSSWIQES 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 58/243 (24%)
Tryp_SPc 83..314 CDD:238113 60/246 (24%)
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 60/245 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.