DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG3916

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:263 Identity:81/263 - (30%)
Similarity:117/263 - (44%) Gaps:64/263 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHE-YPWMIMLM------WFGNFYCGASLVNDQYALTAAHCV-------------- 125
            ||.|||  .|:| .|:.:.|.      |  ..:||.|:|:.|:.||||||:              
  Fly    30 RINGGQ--RVNETVPFQVSLQMQRRGRW--QHFCGGSIVSGQHVLTAAHCMEKMKVEDVSVVVGT 90

  Fly   126 -----NGFYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTR-NFDSDIALIRFNEPVRLG 184
                 .|..|||:|    :|                  :||:||.. ...:||||::...|.||.
  Fly    91 LNWKAGGLRHRLVT----KH------------------VHPQYSMNPRIINDIALVKVTPPFRLE 133

  Fly   185 IDMHPVCMPTPSENYAGQTAV-VTGWGALS---EGGPISDTLQEVEVPILSQEECRNSNYGESKI 245
            .......:...|:....:..| :||||:.|   ....:.|.||.:....:|.|:|....:   ::
  Fly   134 RSDISTILIGGSDRIGEKVPVRLTGWGSTSPSTSSATLPDQLQALNYRTISNEDCNQKGF---RV 195

  Fly   246 TDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDW 310
            |.|.|||..|:  |:.:|.||||||:  :..|....|.||||:|........|.|||||.||..:
  Fly   196 TRNEICALAVQ--GQGACVGDSGGPL--IRPGKQPHLVGIVSYGSSTCAQGRPDVYTRVSSFLPY 256

  Fly   311 IAE 313
            |::
  Fly   257 ISQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 80/259 (31%)
Tryp_SPc 83..314 CDD:238113 80/262 (31%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 80/259 (31%)
Tryp_SPc 31..260 CDD:238113 80/262 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.