DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG17404

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_650165.2 Gene:CG17404 / 41482 FlyBaseID:FBgn0038001 Length:275 Species:Drosophila melanogaster


Alignment Length:272 Identity:89/272 - (32%)
Similarity:129/272 - (47%) Gaps:47/272 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 GNINTR-------HRIVGGQETEVHEY-PWMIMLMWFGN----FYCGASLVNDQYALTAAHCVNG 127
            |.:|:|       ||||||.:....|: |:.:.|.:...    .:||.|::.....||||||..|
  Fly    20 GRLNSRQPSGYTPHRIVGGADIPPGEHVPYQVSLQYRTRGGQMHFCGGSIIAPNRILTAAHCCQG 84

  Fly   128 FYHRLITV----RLLEHNRQDSHVKIVDRRVSRVL---IHPKYSTRNFDSDIALIRFNEPVRL-G 184
            .....::|    |.|  |.:.|.        |:||   |||||. ....||:|::....|::| .
  Fly    85 LNASRMSVVAGIRGL--NEKGSR--------SQVLSYSIHPKYQ-ELVTSDLAVLSIKPPLKLNN 138

  Fly   185 IDMHPVCMPTPSENY--AGQTAVVTGWG-ALSEGGPISD------TLQEVEVPILSQEECRNSNY 240
            ..:..:...:..:::  .|....:|||| .|....|..|      .||.:....:|..||||:  
  Fly   139 STISAIEYRSQGKDFVGGGVPVTLTGWGLRLPVPFPFLDNVNYPNVLQRMSYHTISNSECRNA-- 201

  Fly   241 GESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWG-EGCAKPNAPGVYTRV 304
            |...:||..|||....:|   :|.||||||: |:.|.:..|..||||:| ..|....:|.|||||
  Fly   202 GMESVTDTEICARGPFRG---ACSGDSGGPL-VMESKNGLQQVGIVSYGLVVCGLYISPDVYTRV 262

  Fly   305 GSFNDWIAENTR 316
            .:|:|||...|:
  Fly   263 STFSDWIGNQTK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 82/251 (33%)
Tryp_SPc 83..314 CDD:238113 83/253 (33%)
CG17404NP_650165.2 Tryp_SPc 34..269 CDD:214473 82/251 (33%)
Tryp_SPc 35..269 CDD:238113 81/250 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.