DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:298 Identity:102/298 - (34%)
Similarity:148/298 - (49%) Gaps:38/298 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NNLAQLRQSSFLDWIQSILGPEVPAEW-----SSPAKRECAECSCGNINTR---HRIVGGQETEV 91
            ||:     ..|.|.:::||..::.::.     ||..|..    .||.....   |::.|||:.|.
  Rat   140 NNV-----EKFWDSVETILYQKLKSQTRLLIDSSSFKFS----GCGRRTITPGGHKVAGGQDAEE 195

  Fly    92 HEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSHVKI------- 149
            .|:||...|.......|||:|:::.:.:|||||.         ||  ..|.:|..|..       
  Rat   196 GEWPWQASLQQNNVHRCGATLISNSWLITAAHCF---------VR--SANPKDWKVSFGFLLSKP 249

  Fly   150 -VDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENY-AGQTAVVTGWGAL 212
             ..|.|..::||..||....::|||::|.:.||....::...|:|..::.: .....||||||.|
  Rat   250 QAQRAVKSIVIHENYSYPAHNNDIAVVRLSSPVLYENNIRRACLPEATQKFPPNSDVVVTGWGTL 314

  Fly   213 SEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSG 277
            ...|...:.||:..|.|:..:.|.:.......||..|:|||::| |..|:||||||||:....|.
  Rat   315 KSDGDSPNILQKGRVKIIDNKTCNSGKAYGGVITPGMLCAGFLE-GRVDACQGDSGGPLVSEDSK 378

  Fly   278 DAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENT 315
            ..:.||||||||:.||.||.|||||||..:.|||:..|
  Rat   379 GIWFLAGIVSWGDECALPNKPGVYTRVTHYRDWISSKT 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 87/237 (37%)
Tryp_SPc 83..314 CDD:238113 89/239 (37%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699 6/21 (29%)
Tryp_SPc 186..412 CDD:214473 87/237 (37%)
Tryp_SPc 187..415 CDD:238113 89/239 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 178 1.000 Inparanoid score I3918
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.