DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and prss29

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001001228.1 Gene:prss29 / 407909 XenbaseID:XB-GENE-6453402 Length:330 Species:Xenopus tropicalis


Alignment Length:260 Identity:104/260 - (40%)
Similarity:138/260 - (53%) Gaps:18/260 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSH 146
            |||||.::|..|:||.|.|.:.|.|.||.||:.|.:.||||||.:.......|..|..:...|..
 Frog    25 RIVGGTDSEEGEWPWQISLEFEGGFLCGGSLLTDSWVLTAAHCFDSMNVSKYTAYLGVYQLSDLD 89

  Fly   147 VKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENY-AGQTAVVTGWG 210
            ..:: |.|..:.:||.|.......|||||...||:.....:.|||:|:..... .|....|||||
 Frog    90 NAVL-RGVKNITVHPDYMYEGSSGDIALIELEEPIVFTPSIQPVCLPSQDVPLPMGTMCWVTGWG 153

  Fly   211 ALSEGGPISD--TLQEVEVPILSQEECR---NSNYGESK----ITDNMICAGYVEQGGKDSCQGD 266
            .:.|..|:.|  |||:.||.::::..|.   .|:.|...    |.|:|||||| :||..|:||||
 Frog   154 NIKENTPLEDPQTLQKAEVGLINRTSCEAMYQSSLGYRPSIHLIQDDMICAGY-KQGKIDACQGD 217

  Fly   267 SGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTRDACSCAQPEAAGEPA 331
            ||||: |..:.:.:...||||||.|||:||.|||||.|..:..||.|.......|     .|||:
 Frog   218 SGGPL-VCNTSNTWLQFGIVSWGLGCAEPNQPGVYTNVQYYLTWIQELVPSVMFC-----DGEPS 276

  Fly   332  331
             Frog   277  276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 97/238 (41%)
Tryp_SPc 83..314 CDD:238113 98/240 (41%)
prss29NP_001001228.1 Tryp_SPc 26..263 CDD:238113 98/239 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 183 1.000 Inparanoid score I3837
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.