DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and MP1

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:296 Identity:105/296 - (35%)
Similarity:155/296 - (52%) Gaps:42/296 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PAEWSSPAKRECAEC-----SCGNINTRHRIVGGQETEVHEYPWMIMLMWF--GN---FYCGASL 112
            |.:.:.|.||...:.     :||. |...|:|||.||...|:|||.::.:.  ||   .:||.||
  Fly   109 PTQTTKPTKRSGTKLLPMAPNCGE-NFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSL 172

  Fly   113 VNDQYALTAAHCVNGFYH--RLITVRLLE-------------HNRQDSHVKIVDRRVSRVLIHPK 162
            :|.:|.|||||||:....  .|..|||.|             :.|:|.:...||..|...:.||:
  Fly   173 INHRYVLTAAHCVSAIPSDWELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQ 237

  Fly   163 Y--STRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSEN----YAGQTAVVTGWGALSEGGPISDT 221
            |  ::|:..:||||:|..:.|:....:.|||:||.:..    :.|:..||.|||. :|....|:.
  Fly   238 YPGNSRDQLNDIALLRLRDEVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGR-TETNFTSNI 301

  Fly   222 LQEVEVPILSQEECRNSNYGESK--ITDNMICAGYVEQGGKDSCQGDSGGPMHV--LGSGDA-YQ 281
            ..:.|:..:...|| |..|...:  :|...:|||.||  |.|||:||||||:.:  ..:|:: |.
  Fly   302 KLKAELDTVPTSEC-NQRYATQRRTVTTKQMCAGGVE--GVDSCRGDSGGPLLLEDYSNGNSNYY 363

  Fly   282 LAGIVSWG-EGCAKPNAPGVYTRVGSFNDWIAENTR 316
            :||:||:| ..|.....|||||||.::.:||..|.|
  Fly   364 IAGVVSYGPTPCGLKGWPGVYTRVEAYLNWIENNVR 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 94/260 (36%)
Tryp_SPc 83..314 CDD:238113 95/262 (36%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 94/260 (36%)
Tryp_SPc 138..397 CDD:238113 95/262 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.