DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Sems

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster


Alignment Length:255 Identity:82/255 - (32%)
Similarity:123/255 - (48%) Gaps:49/255 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQ-ETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHC-----------VNGFYHRLIT 134
            |::||: .|......:::.:.:|.||.||.:|:::...||||||           |:|...||  
  Fly    43 RVIGGRVTTNAKLGGYLVAMRYFNNFICGGTLIHELIVLTAAHCFEDRAEKEAWSVDGGISRL-- 105

  Fly   135 VRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEP-VRLGIDMHPVCMP--TPS 196
                       ..|.:.|:|.|.:...::.....:.|:|::..|.| |...|....:|..  || 
  Fly   106 -----------SEKGIRRQVKRFIKSAQFKMVTMNMDVAVVLLNRPMVGKNIGTLSLCSTALTP- 158

  Fly   197 ENYAGQTAVVTGWGALS--EGGPISDTLQEVEVPILSQEECRNSNYGES-KITDNMICAGYVEQG 258
                |||..|:|||..:  :.|| ...|:.|.||::.:..||.: |.|| .|:|:|.||..:  |
  Fly   159 ----GQTMDVSGWGMTNPDDEGP-GHMLRTVSVPVIEKRICREA-YRESVSISDSMFCASVL--G 215

  Fly   259 GKDSCQGDSGGPMHVLGSGDAY--QLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTR 316
            .||:|..|||||:       .|  |:.||||:|.|||....|||||.|.....:|.:..:
  Fly   216 KKDACTYDSGGPL-------VYEKQVCGIVSFGIGCASRRYPGVYTDVHYVKPFIVKGIK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 81/248 (33%)
Tryp_SPc 83..314 CDD:238113 81/250 (32%)
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 81/248 (33%)
Tryp_SPc 44..265 CDD:238113 81/249 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.