DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG4998

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001036609.1 Gene:CG4998 / 39808 FlyBaseID:FBgn0036612 Length:1185 Species:Drosophila melanogaster


Alignment Length:285 Identity:99/285 - (34%)
Similarity:149/285 - (52%) Gaps:32/285 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LGPEVPAEWSSPAKRECAECSCGNINTRHR---IVGGQETEVHEYPWMIMLM----WFGNFYCGA 110
            |.|:.|.:...    .|...:...|..|.:   .|.| ::|..||||.:.::    ....:.||.
  Fly   909 LRPQAPPQQFG----RCGVRNAAGITGRIKNPVYVDG-DSEFGEYPWHVAILKKDPKESIYACGG 968

  Fly   111 SLVNDQYALTAAHCV---NGFYHRLITVRLLEH--NRQDSHVKIVDRRVSRVLIHPKYSTRNFDS 170
            :|::.|:.::||||:   |||..|   |||.|.  |........::|.|..|.|||:|.....|:
  Fly   969 TLIDAQHIISAAHCIKSQNGFDLR---VRLGEWDVNHDVEFFPYIERDVVSVHIHPEYYAGTLDN 1030

  Fly   171 DIALIRFNEPVRLGIDMH--PVCMPTPSENYAGQTAVVTGWG--ALSEGGPISDTLQEVEVPILS 231
            |:|:::.::||....:.|  |.|:|....::.|.....||||  |..|.|...:.|:||:|||||
  Fly  1031 DLAVLKLDQPVDFTKNPHISPACLPDKYSDFTGARCWTTGWGKDAFGEHGKYQNILKEVDVPILS 1095

  Fly   232 QEEC----RNSNYGES-KITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEG 291
            .::|    ||:..|.| |:....:|||..|  |||:|:||.|||: |.....|..:.|:||||.|
  Fly  1096 HQQCESQLRNTRLGYSYKLNPGFVCAGGEE--GKDACKGDGGGPL-VCDRNGAMHVVGVVSWGIG 1157

  Fly   292 CAKPNAPGVYTRVGSFNDWIAENTR 316
            |.:.|.||||.:|.::..||.:.|:
  Fly  1158 CGQVNVPGVYVKVSAYLPWIQQITQ 1182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 90/249 (36%)
Tryp_SPc 83..314 CDD:238113 92/248 (37%)
CG4998NP_001036609.1 Tryp_SPc 942..1180 CDD:238113 90/243 (37%)
Tryp_SPc 942..1177 CDD:214473 88/240 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.