DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG4914

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster


Alignment Length:315 Identity:142/315 - (45%)
Similarity:183/315 - (58%) Gaps:23/315 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LGDLACATPSLRSASDPEKILNNLAQLRQSSFLDWIQSILGPEVPA--EWSSPAKRECAECSCGN 76
            :||:..      |:||..|.:     .||:...:|..:......||  ..:||.   |: |.||.
  Fly    72 IGDVNA------SSSDANKPV-----FRQNPIKNWFGAFNRNNSPAAQNQTSPT---CS-CRCGE 121

  Fly    77 INTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHN 141
            .|...|||||..|.|.|||||..|.:|..||||.:|:||:|.|||||||.||...:|.|...||:
  Fly   122 RNDESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCVKGFMWFMIKVTFGEHD 186

  Fly   142 RQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSEN---YAGQT 203
            |.:...:...|.|.|. ...|:|..|||:||||:|.|:.|.:...:.|:|:|...:.   :.|..
  Fly   187 RCNDKERPETRFVLRA-FSQKFSFSNFDNDIALLRLNDRVPITSFIRPICLPRVEQRQDLFVGTK 250

  Fly   204 AVVTGWGALSEGGPISDTLQEVEVPILSQEEC-RNSNYGESKITDNMICAGYVEQGGKDSCQGDS 267
            |:.||||.|.|.|..|..|||||||:|..:|| ..:||.:..||.||:|:||...||:|||||||
  Fly   251 AIATGWGTLKEDGKPSCLLQEVEVPVLDNDECVAQTNYTQKMITKNMMCSGYPGVGGRDSCQGDS 315

  Fly   268 GGPMHVLGSGD-AYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTRDACSC 321
            |||:..|...| .::..||||||.|||:||.|||||||..:.|||.||:||.|.|
  Fly   316 GGPLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYLDWIVENSRDGCFC 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 116/233 (50%)
Tryp_SPc 83..314 CDD:238113 117/235 (50%)
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 116/233 (50%)
Tryp_SPc 128..363 CDD:238113 117/235 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I2933
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D19085at50557
OrthoFinder 1 1.000 - - FOG0001240
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
88.070

Return to query results.
Submit another query.